Reconstitution comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2025-03-06. Numbers and descriptions here follow the published literature rather than marketing material.
Lyophilized peptides are supplied as dry powders or porous cakes that remain stable during shipment and short-term storage. Reconstitution is the laboratory step of adding a suitable solvent so the solid dissolves into a liquid stock. The dried state limits hydrolysis and microbial growth, but it does not remove all residual water or salts. Sequence, counterion, and manufacturing method influence how quickly and completely a peptide enters solution. Researchers treat reconstitution as a practical starting point for later dilution, analysis, or assay work.
Solvent choice depends on peptide polarity and intended use. Many peptides dissolve in water or buffered aqueous solutions, while hydrophobic sequences may need a small amount of organic solvent such as acetonitrile or dimethyl sulfoxide before aqueous dilution. The solvent should match the downstream analytical method and not interfere with detection. Gentle mixing or brief sonication can help, but vigorous agitation may promote foaming or aggregation. Complete dissolution is judged by a clear liquid free of visible particles, though some turbidity can persist.
Reconstitution concentration is chosen from the mass of peptide and the volume of solvent added. Researchers often prepare a concentrated stock and then divide it into single-use aliquots to reduce freeze-thaw cycling. The actual peptide content may differ from label mass because of counterions, water, or impurities. For that reason, quantitative work may require independent measurement such as amino acid analysis or ultraviolet absorbance. Records of solvent, volume, date, and lot help trace later observations.
Quality checks after reconstitution include visual inspection, pH measurement, and analytical methods such as reversed-phase high-performance liquid chromatography. These tests can detect insoluble material, degradation products, and changes in concentration. Mass spectrometry is often used to confirm molecular identity when the peptide sequence is known. Because a clear solution can still contain aggregates or modified peptide, visual clarity alone is not sufficient. Analytical results are compared with a reference standard or the pre-reconstitution certificate of analysis.
Container selection matters because peptides can adsorb to glass, plastic, and filter membranes. Low-binding polypropylene tubes reduce losses for hydrophobic sequences, and filtration through a 0.22 µm membrane can remove particulates and microorganisms. Some peptides may bind to certain filter materials, so compatibility should be checked. Aliquots should be prepared before freezing to avoid repeated temperature cycling. Labels should record the peptide identity, lot number, solvent, concentration, reconstitution date, and storage condition.
After reconstitution, the peptide solution is less stable than the dried powder because water enables hydrolysis, oxidation, and microbial growth. Storage temperature, pH, buffer composition, and container material all affect how long the solution remains usable. Many peptides are kept at 2–8 °C for short-term work, while frozen aliquots at −20 °C or below are used for longer intervals. Repeated freeze-thaw cycles can cause aggregation or precipitation. The choice of storage condition should be based on stability data for the specific peptide.
| Property | Value | Notes |
|---|---|---|
| Appearance (lyophilized) | White to off-white powder or cake | Depends on peptide sequence, counterion, and manufacturing process |
| Appearance (reconstituted) | Clear to slightly hazy solution | Visible particles may indicate incomplete dissolution or aggregation |
| Solubility class | Aqueous or organic-dependent | Hydrophilic peptides often dissolve in water; hydrophobic peptides may require acetonitrile or dimethyl sulfoxide |
| Typical storage temperature (lyophilized) | -20 °C or lower | Desiccated, protected from light, and allowed to equilibrate before opening |
| Typical analytical method | Reverse-phase HPLC or LC-MS | Used to confirm identity, purity, and concentration after dissolution |
Reconstitution is the process of dissolving a lyophilized peptide powder in a suitable liquid to produce a solution for laboratory or clinical use. The dry powder is typically a porous cake or fluffy solid formed by freeze-drying an aqueous or mixed-solvent preparation. Adding solvent restores the peptide to a dissolved state, but the result is not necessarily identical to the original pre-lyophilization solution. Factors such as pH, ionic strength, temperature, and the peptide's sequence influence how completely and quickly dissolution occurs. The term is distinct from dilution, which lowers concentration without changing the physical state of an already dissolved material.
Solvent selection depends on the peptide's charge, hydrophobicity, and intended application. Many lyophilized peptides dissolve readily in water, while others require a small amount of a miscible organic solvent, a dilute acid, or a dilute base before aqueous dilution. A buffer may be used when a stable pH range is known, but adding buffer salts can also promote aggregation or precipitation. Dissolution should be observed rather than assumed, because a clear solution does not prove that the peptide is monomeric or fully active. The order of solvent addition and the final volume matter for achieving the intended concentration.
Once reconstituted, a peptide solution is generally less stable than the dry powder. Hydrolysis, oxidation, aggregation, and microbial growth can change the preparation over time, so storage temperature and duration are practical concerns. Dividing a solution into single-use aliquots before freezing can reduce repeated freeze-thaw cycles, which may otherwise cause precipitation or loss of activity. The optimal storage conditions vary by peptide, and no single rule applies to all sequences. Records of solvent, concentration, date, and storage history help maintain traceability. Studies often report stability under defined conditions rather than universal shelf lives.
After reconstitution, a peptide solution is typically stored under conditions that limit degradation. Cool temperatures slow hydrolysis and oxidation, while freezing can preserve samples for longer periods. Repeated freeze-thaw cycles may promote aggregation or precipitation, so aliquoting before freezing is a common laboratory practice. The optimal storage temperature depends on the peptide sequence, buffer composition, and expected duration. Solutions containing oxidizable residues may benefit from inert gas overlays or antioxidants, though compatibility with the specific peptide must be considered.
Aseptic technique matters because aqueous peptide solutions can support microbial growth. Sterile solvents, clean workspaces, and sterile filtration can reduce contamination. The choice of filter material and pore size must avoid peptide loss through adsorption, especially for hydrophobic or low-concentration samples. Visual inspection for particles, turbidity, or color change provides a simple initial check, but it cannot confirm identity or purity. Analytical methods such as reversed-phase high-performance liquid chromatography and mass spectrometry are used to verify composition and detect degradation products.
Documentation supports reproducibility and traceability. Records often include lot number, solvent composition, final concentration, preparation date, and storage location. Such details help distinguish procedural variation from actual sample instability. Questions remain about how best to predict long-term stability from short-term accelerated studies, because peptide degradation pathways differ widely. For many peptides, the relationship between in vitro solution stability and biological behavior is incompletely understood and is an active area of research.
On 1 December 1978, the Health and Safety Executive announced their intention to prosecute the university for breach of safety legislation. The case was heard in October 1979 at Birmingham Magistrates' Court. Although the source of infection was traced, the mode and cause of transmission was not. Evidence presented by several internationally recognised experts, including Kevin McCarthy, Allan Watt Downie and Keith R. Dumbell, showed that airborne transmission from the laboratory to the telephone room where Parker was supposedly infected was highly improbable. The experts calculated that it would require 53,700 litres (11,812 imp gal) of virus fluid to have been aspirated (meaning, in this context, removed by suction of fluid and cells through a needle) and it would take 20,000 years for one particle to travel to the telephone room at the rate the fluid was aspirated. It was additionally found that although the Shooter Inquiry noted the poor state of the duct sealing in the laboratory, this was caused after the outbreak by engineers fumigating the laboratory and ducts. The university was found not guilty of causing Parker's death.
An alpha helix (or α-helix) is a sequence of amino acids in a protein that are twisted into a coil (a helix). The alpha helix is the most common structural arrangement in the secondary structure of proteins. It is also the most extreme type of local structure, and it is the local structure that is most easily predicted from a sequence of amino acids. The alpha helix has a right-handed helix conformation in which every backbone N−H group hydrogen bonds to the backbone C=O group of the amino acid that is four residues earlier in the protein sequence. The alpha helix is also commonly called a: Pauling–Corey–Branson α-helix (from the names of three scientists who described its structure) 3.613-helix because there are 3.6 amino acids in one ring, with 13 atoms being involved in the ring formed by the hydrogen bond (starting with amidic hydrogen and ending with carbonyl oxygen)
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
In 1961, Peter Mitchell proposed chemiosmosis as a cell's primary system of energy conversion. The mechanism, now ubiquitous in living cells, powers energy conversion in micro-organisms and in the mitochondria of eukaryotes, making it a likely candidate for early life. Mitochondria produce adenosine triphosphate (ATP), the energy currency of the cell used to drive cellular processes such as chemical syntheses. The mechanism of ATP synthesis involves a closed membrane in which the ATP synthase enzyme is embedded. The energy required to release strongly bound ATP has its origin in protons that move across the membrane. In modern cells, those proton movements are caused by the pumping of ions across the membrane, maintaining an electrochemical gradient. In the first organisms, the gradient could have been provided by the difference in chemical composition between the flow from a hydrothermal vent and the surrounding seawater, or perhaps meteoric quinones that were conducive to the development of chemiosmotic energy across lipid membranes if at a terrestrial origin.
Sources: en.wikipedia.org
Aside from the 22 proteinogenic amino acids, many non-proteinogenic amino acids are known. These either are not found in proteins (for example carnitine, GABA, ornithine) or are not produced directly and in isolation by standard cellular machinery. For example, hydroxyproline is synthesized from proline, and selenomethionine is produced by metabolic modification of methionine. Non-proteinogenic amino acids that are found in proteins are formed by post-translational modification. Such modifications can also determine the localization of the protein, e.g., the addition of long hydrophobic groups can cause a protein to bind to a phospholipid membrane. Examples:
The enzyme converts adenosine to adenosine monophosphate by transferring a phosphate group. Adenosine diphosphate is produced as a byproduct: The AdK gene/protein is mainly found in eukaryotic organisms and its primary sequence shows a high degree of conservation (>55% aa similarity). However, AdK sequences exhibit low (~ 20-25%), but significant similarity to other PfkB family of proteins such as RK and phosphofructokinases, which are also found in prokaryotic organisms. Although a protein exhibiting AdK activity has been reported in Mycobacterium tuberculosis, sequence and biochemical characteristics of this enzyme reveal it to be an atypical enzyme that is more closely related to ribokinase and fructokinase (35%) than to other ADKs (less than 24%).
Protein Data Bank (PDB) is a database of three dimensional structures of biological macromolecules, such as proteins and nucleic acids. The data are typically obtained by X-ray crystallography or nuclear magnetic resonance spectroscopy (NMR spectroscopy), and submitted manually by structural biologists worldwide through PDB member organizations – PDBe, RCSB, PDBj and BMRB. The database can be accessed through the webpages of its members, including PDBe (housed at the EMBL-EBI). As a member of the Worldwide Protein Data Bank (wwPDB) consortium, PDBe aids in the joint mission of archiving and maintenance of macromolecular structure data.
Sources: en.wikipedia.org
Prior to development of AS9100 standards for Quality Management Systems, the U.S. military applied two specifications to supplier quality and inspection programs, respectively, MIL-Q-9858A Quality Program Requirements, and MIL-I-45208A Military Specification: Inspection System Requirements. For years these specifications had represented the basic tenets of the aerospace industry. However, when the U.S. government adopted ISO 9001, it withdrew those two quality standards. Large aerospace companies then began requiring their suppliers to develop quality programs based on ISO 9001. As technologies evolve, and industries become more specialized, it is likely that more updates will be made to these standards and additional specialty Quality Management Systems (QMS) requirements for various industries.
Radiation therapy is usually reserved for people who have tumours remaining after surgery. These people often also receive medication to lower GH levels. Radiation therapy is given in divided doses over four to six weeks. This treatment lowers GH levels by about 50 percent over 2 to 5 years. People monitored for more than 5 years show significant further improvement. Radiation therapy causes a gradual loss of production of other pituitary hormones with time. Loss of vision and brain injury, which have been reported, are very rare complications of radiation treatments.
Colony-forming unit-fibroblast Mesenchymal stem cell / marrow stromal cell Chondrocyte Hypertrophic chondrocyte Mesenchymal (mesoderm origin) stem cells are undifferentiated, meaning they can differentiate into a variety of generative cells commonly known as osteochondrogenic (or osteogenic, chondrogenic, osteoprogenitor, etc.) cells. When referring to bone, or in this case cartilage, the originally undifferentiated mesenchymal stem cells lose their pluripotency, proliferate and crowd together in a dense aggregate of chondrogenic cells (cartilage) at the location of chondrification. These chondrogenic cells differentiate into so-called chondroblasts, which then synthesize the cartilage extracellular matrix (ECM), consisting of a ground substance (proteoglycans, glycosaminoglycans for low osmotic potential) and fibers. The chondroblast is now a mature chondrocyte that is usually inactive but can still secrete and degrade the matrix, depending on conditions. Cell culture studies of excess Vitamin B inhibits the synthesis of chondroitin sulfate by chondrocytes and causes the inhibition of chondrogenesis in the developing embryo which may result in limb malformations. Chondrocytes undergo terminal differentiation when they become hypertrophic, which happens during endochondral ossification. This last stage is characterized by major phenotypic changes in the cell.
Sources: en.wikipedia.org
The solvent depends on peptide sequence and application. Water or aqueous buffer works for many hydrophilic peptides, while hydrophobic peptides may require a water-miscible organic solvent. The chosen solvent must be compatible with the assay or analytical instrument.
No. Some material may remain as insoluble particles, adsorb to surfaces, or degrade during handling. Recovery can be checked by analytical methods such as chromatography or mass spectrometry.
Aliquoting limits repeated freezing and thawing, which can cause aggregation or loss. Single-use portions also reduce contamination risk. Storage conditions depend on peptide stability.
Short-term storage is often at 2 to 8 °C, while longer storage may use frozen aliquots at −20 °C or below. Repeated freeze-thaw cycles should be avoided because they can promote aggregation.